PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_22087A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 311aa    MW: 34079.8 Da    PI: 7.2612
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_22087AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.9e-171461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Oropetium_20150105_22087A 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPINTGLMRCSKSCRLRWTNYL 61
                               79********************************************97 PP

2Myb_DNA-binding47.54.1e-1567112148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                rg++T+ E+ ++v++  +lG++ W++Ia++++  Rt++++k++w+++l
  Oropetium_20150105_22087A  67 RGNFTPHEEGIIVHLQSLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                                89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129425.042965IPR017930Myb domain
SuperFamilySSF466893.18E-3011108IPR009057Homeodomain-like
SMARTSM007174.4E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
CDDcd001678.55E-121661No hitNo description
Gene3DG3DSA:1.10.10.606.4E-2465117IPR009057Homeodomain-like
SMARTSM007175.4E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129418.7466116IPR017930Myb domain
PfamPF002495.4E-1367112IPR001005SANT/Myb domain
CDDcd001675.32E-969110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MGRPPCCDKV GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PINTGLMRCS KSCRLRWTNY  60
LRPGIRRGNF TPHEEGIIVH LQSLLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKHQ  120
AIGAIFAPPP SELSTAVPGL TGVTGHADHH HPVITTNPLS KDNYTRSTCS NPGDVTQFTP  180
RRSPFTAPSS LDADSGSCSS SYASSMDNIS KLLDGFMKST TSPNEAADIK PLATEVNPLL  240
SFEHNMSAGS ALPAFADVLP PQPVLMEQPK QQQAQAPLWS IEKWLLDEAT EQVADLMALS  300
DDCCPVPMLF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7283081e-145KJ728308.1 Zea mays clone pUT6588 MYB transcription factor (MYB69) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978476.11e-134PREDICTED: transcription factor MYB30-like
TrEMBLL0P1U91e-140L0P1U9_9POAL; PH01B001E05.10 protein
STRINGSi026651m1e-134(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.12e-83myb domain protein 60